Glyma20g26940 - SoyBase

SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g26940

Feature Type:	gene_model
Chromosome:	Gm20
Start:	36238287
stop:	36239858
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g26940

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G27730	AT	Annotation by Michelle Graham. TAIR10: salt tolerance zinc finger \| chr1:9648302-9648985 REVERSE LENGTH=227	SoyBase	E_val: 6.00E-48	ISS
GO:0002679	GO-bp	Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response	SoyBase	N/A	ISS
GO:0006979	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to oxidative stress	SoyBase	N/A	ISS
GO:0007165	GO-bp	Annotation by Michelle Graham. GO Biological Process: signal transduction	SoyBase	N/A	ISS
GO:0009409	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cold	SoyBase	N/A	ISS
GO:0009414	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to water deprivation	SoyBase	N/A	ISS
GO:0009611	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to wounding	SoyBase	N/A	ISS
GO:0009612	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to mechanical stimulus	SoyBase	N/A	ISS
GO:0009620	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to fungus	SoyBase	N/A	ISS
GO:0009644	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to high light intensity	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0009695	GO-bp	Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process	SoyBase	N/A	ISS
GO:0009723	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus	SoyBase	N/A	ISS
GO:0009733	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus	SoyBase	N/A	ISS
GO:0009737	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus	SoyBase	N/A	ISS
GO:0009738	GO-bp	Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009753	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus	SoyBase	N/A	ISS
GO:0009873	GO-bp	Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway	SoyBase	N/A	ISS
GO:0010117	GO-bp	Annotation by Michelle Graham. GO Biological Process: photoprotection	SoyBase	N/A	ISS
GO:0010200	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to chitin	SoyBase	N/A	ISS
GO:0015979	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis	SoyBase	N/A	ISS
GO:0035264	GO-bp	Annotation by Michelle Graham. GO Biological Process: multicellular organism growth	SoyBase	N/A	ISS
GO:0035556	GO-bp	Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction	SoyBase	N/A	ISS
GO:0042538	GO-bp	Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response	SoyBase	N/A	ISS
GO:0045892	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003676	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
GO:0043565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding	SoyBase	N/A	ISS
PTHR26374	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR26374:SF459	Panther		JGI		ISS
UniRef100_C0ITH8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Zinc finger protein n=1 Tax=Cicer arietinum RepID=C0ITH8_CICAR	SoyBase	E_val: 2.00E-87	ISS
UniRef100_I1NG21	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NG21_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma20g26940

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma20g26940

Paralog	Evidence	Comments
Glyma10g40400	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma20g26940 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.20g133200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma20g26940

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g26940

Limit To All Plant Sequences

>Glyma20g26940.1   sequence type=CDS   gene model=Glyma20g26940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTTGGAGGCTTTGAATTCACCAACAGCAGCCACCACTCCGTTCCGTGGCTACCAAGAAGAGGAGGAGGACGAGGAGGCTGACCTTCACTTACGTGAGCCTTGGGCTAAAAGGAAACGCTCCAAACGACCGCGTTTTGAGACGGAGGAAGAGTACCTCGCTCTTTGCCTCATCATGCTCGCACAAAGCGGTAACACCAGAAACATCCACAACAACAACACCCAATTACCGTCTTCTTCACTGTCAGACAAAGAAGCGTCGCCGCCGGTGAAACTAACACACAGGTGCACCGTTTGCAACAAGGCCTTTGGTTCTTATCAAGCACTCGGTGGACACAAGGCCAGCCACCGCAAGGCCTCGTCGGAATCCAACCCCACCGCCTCCGTCTCTGCCCTAGCCAACGACAGCGTTTCTGCTTCCACCGTCGGCGGCGGAAGGATGCACGAGTGTTCCATCTGTCACAAGAGTTTCCCTACCGGTCAGGCCCTGGGTGGCCACAAGCGCTGCCACTACGACGGCGGGAACAACCACAGTAACAGCAACGCCAACGGAAACAACAGCAGCGGCGCCACTACCTCCGACGGCGGCGCTGCCTCCTCCTCCCACACGCTCCGTGGGTTTGACCTGAACCTTCCGGCGCCGCTGACGGAGTTCTGGTCGCCGATGGGGTTTGATTTCGGGAAGAAGAAGGTAGGCGGTGAACAAGAGGTGGAAAGCCCGTTGCCGGTAACCGCCAAGAGGCCGCGTTTGTTTACAGGGGAAGATGATGAAACCGCGTAG

Predicted protein sequences of Glyma20g26940

Limit To All Plant Sequences

>Glyma20g26940.1   sequence type=predicted peptide   gene model=Glyma20g26940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALEALNSPTAATTPFRGYQEEEEDEEADLHLREPWAKRKRSKRPRFETEEEYLALCLIMLAQSGNTRNIHNNNTQLPSSSLSDKEASPPVKLTHRCTVCNKAFGSYQALGGHKASHRKASSESNPTASVSALANDSVSASTVGGGRMHECSICHKSFPTGQALGGHKRCHYDGGNNHSNSNANGNNSSGATTSDGGAASSSHTLRGFDLNLPAPLTEFWSPMGFDFGKKKVGGEQEVESPLPVTAKRPRLFTGEDDETA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain